PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01946.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 529aa    MW: 57979.7 Da    PI: 7.7394
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01946.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.81.4e-1610491756
                                    HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                    +lF+++++p++++r eL+k+lgL+ rqVk+WFqNrR+++k
  Zmw_sc01946.1.g00030.1.sm.mkhc 10 RLFKECPHPDEKQRGELSKRLGLDPRQVKFWFQNRRTQMK 49
                                    79***********************************999 PP

2START1341.7e-4215327194206
                                     EEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE.....-TTS--....-TTSEE-EESSEEEEEEEECTCEEE CS
                           START  94 mvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd.....seqkppe...sssvvRaellpSgiliepksnghsk 163
                                     m+aelq+lsplvp R+++f+R+++ql +g w++vdvSvd     +++       +++ v++++lpSg+++++++ng++k
  Zmw_sc01946.1.g00030.1.sm.mkhc 153 MKAELQVLSPLVPiREVTFLRFSKQLAEGAWAVVDVSVDgllrdQNS---AttsTAGNVKCRRLPSGCVMQDTPNGYCK 228
                                     99************************************844221233...24569************************ PP

                                     EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                           START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                     vtwveh++++++++h+l+r+l++sgla+ga++w+atlqrqce+
  Zmw_sc01946.1.g00030.1.sm.mkhc 229 VTWVEHTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCEC 271
                                     *****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003898.4E-9555IPR001356Homeobox domain
PROSITE profilePS5007114.544851IPR001356Homeobox domain
SuperFamilySSF466898.36E-14955IPR009057Homeodomain-like
CDDcd000868.26E-14951No hitNo description
PfamPF000465.6E-141049IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-151058IPR009057Homeodomain-like
PROSITE patternPS0002702649IPR017970Homeobox, conserved site
SMARTSM002348.0E-1445271IPR002913START domain
SuperFamilySSF559612.89E-20151271No hitNo description
PfamPF018524.9E-37153271IPR002913START domain
PROSITE profilePS5084827.225159274IPR002913START domain
SuperFamilySSF559611.24E-21291512No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MDSCPCCVRR LFKECPHPDE KQRGELSKRL GLDPRQVKFW FQNRRTQMKT QLERHENALL  60
KQENDKLRAE NMTIREAMRS PMCGGCGSPA MLGEVSLEEQ HLRIENARLK DELNRVYSLA  120
TKFLGKPLSF MSGYQMQPHL ALPMPSSSLE LAMKAELQVL SPLVPIREVT FLRFSKQLAE  180
GAWAVVDVSV DGLLRDQNSA TTSTAGNVKC RRLPSGCVMQ DTPNGYCKVT WVEHTEYDEA  240
SVHQLYRPLL RSGLAFGARR WLATLQRQCE CLAILMSPDT VSANDASVIT QEGKRSMLKL  300
ARRMTENFCA GVSASSAREW SKLDGAAGSI GEDVRVMARK SVNEPGEPPG VVLSAATSVW  360
VPVAPEKLFN FLRNEQLRAE WDILSNGGPM QEMANIAKGQ GPGNSVSLLR ASAMSANQSS  420
MLILQETCTD ASGSMVVYAP VDIPAMQLVM NGGDSTYVAL LPSGFAILPD APGIDSAEHK  480
TGGSLLTVAF QILVNSQPTA KLTVESVETV NNLISCTIKK IKNALQCDT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457484.10.0hypothetical protein SORBIDRAFT_03g008090
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0E0KU370.0A0A0E0KU37_ORYPU; Uncharacterized protein
STRINGSb03g008090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116